Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB2A Protein

This Human TUBB2A Protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tubulin beta class IIa

UniProt

Q13885

Expression Region

1-445aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC3 Rabbit Polyclonal Antibody
E10G01162 100 µL

CASC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D21 (N-term) Rabbit Polyclonal Antibody
AP54166PU-N 400 µL

TBC1D21 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GJC1 siRNA (Mouse)
CRM1567-01 15 nmol

GJC1 siRNA (Mouse)

Sign In for Pricing
View Details
GJC1 siRNA (Mouse)
CRM1567-02 30 nmol

GJC1 siRNA (Mouse)

Sign In for Pricing
View Details
Plk1, phosphorylated (Thr210) (STPK13, Polo-like kinase 1, Serine-threonine kinase 13) (MaxLight 650) discontinued
P4275-01A-ML650 100 µL

Plk1, phosphorylated (Thr210) (STPK13, Polo-like kinase 1, Serine-threonine kinase 13) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DCK (N-term) rabbit polyclonal antibody, Aff - Purified
AP08307PU-N 50 µg

DCK (N-term) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details