Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZDHHC5 Protein

This Human ZDHHC5 Protein spans the amino acid sequence from region 60-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)

UniProt

Q9C0B5

Expression Region

60-148aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELMO1 (NM_001039459) Human Over-expression Lysate
LC422048 20 µg

ELMO1 (NM_001039459) Human Over-expression Lysate

Sign In for Pricing
View Details
PERP (NM_022121) Human Recombinant Protein
TP304012L 1 mg

PERP (NM_022121) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565684 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
KLHL13 (NM_001168301) Human Over-expression Lysate
LC433380 20 µg

KLHL13 (NM_001168301) Human Over-expression Lysate

Sign In for Pricing
View Details
CD68 (KP1), CF555 conjugate, 0.1mg/mL
BNC550512-500 1x 500 µL

CD68 (KP1), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human RNASE3/ECP (Ribonuclease A3/Eosinophil Cationic Protein) ELISA Kit
E-UNEL-H0292-01 5x 96 Tests

Uncoated Human RNASE3/ECP (Ribonuclease A3/Eosinophil Cationic Protein) ELISA Kit

Sign In for Pricing
View Details