Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate UTY Protein

This Primate UTY Protein spans the amino acid sequence from region 209-317aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ubiquitously transcribed TPR protein on the Y chromosome) (Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein) ([histone H3]-trimethyl-L-lysine (27) demethylase UTY)

UniProt

Q6B4Z3

Expression Region

209-317aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHLYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKATKESYAIPYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFVSYRQSIDRSEASADT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Difluorobenzyl alcohol
TRC-D451438-2.5G 2.5 g

2,6-Difluorobenzyl alcohol

Sign In for Pricing
View Details
OSBPL5 (NM_001144063) Human Over-expression Lysate
LY428490 100 µg

OSBPL5 (NM_001144063) Human Over-expression Lysate

Sign In for Pricing
View Details
Bulk Anti-Human CD28 (CD28.2) Antibody
ICH1013-5mg 5 mg

Bulk Anti-Human CD28 (CD28.2) Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707821 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human ZNF835 activation kit by CRISPRa
GA114025 1 Kit

Human ZNF835 activation kit by CRISPRa

Sign In for Pricing
View Details
PON3/paraoxonase 3 Polyclonal Antibody
E-AB-40576-01 25 µL

PON3/paraoxonase 3 Polyclonal Antibody

Sign In for Pricing
View Details