Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ba71V-126 Protein

This Ba71V-126 Protein spans the amino acid sequence from region 54-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(pE183L)

UniProt

Q65194

Expression Region

54-183aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Field of Research

Apoptotic, Cancer, Infectious Diseases, Neuroscience, Non-Animal, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FERMT3 (KIND3, MIG2B, URP2) discontinued
509452 100 µg

FERMT3 (KIND3, MIG2B, URP2) discontinued

Sign In for Pricing
View Details
WDR8 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV810445 1.0 µg DNA

WDR8 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
2- (4-tert-Butylcyclohexylidene) acetic acid
NAA73351-01 50 mg

2- (4-tert-Butylcyclohexylidene) acetic acid

Sign In for Pricing
View Details
2- (4-tert-Butylcyclohexylidene) acetic acid
NAA73351-02 0.5 g

2- (4-tert-Butylcyclohexylidene) acetic acid

Sign In for Pricing
View Details
M. pneumoniae P1 Monoclonal Antibody (Detection)
orb316658 1 mg

M. pneumoniae P1 Monoclonal Antibody (Detection)

Sign In for Pricing
View Details
Recombinant Human Transcription factor MafB (MAFB)
MBS1421119-01 0.02 mg (E-Coli)

Recombinant Human Transcription factor MafB (MAFB)

Sign In for Pricing
View Details