Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Haemophilus influenzae Peptidoglycan-associated lipoprotein Protein (Biotin)

This Haemophilus influenzae Peptidoglycan-associated lipoprotein Protein (Biotin) spans the amino acid sequence from region 20-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PAL) (15 kDa peptidoglycan-associated lipoprotein) (PC protein) (Outer membrane protein P6) (OMP P6)

UniProt

P10324

Expression Region

20-153aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD5 Rabbit pAb
E2516518 100 µL

COMMD5 Rabbit pAb

Sign In for Pricing
View Details
VPS34-IN1 10mg
A15874-10 10 mg

VPS34-IN1 10mg

Sign In for Pricing
View Details
Rabbit Polyclonal DEGS1 Antibody
NBP1-59941 100 µL

Rabbit Polyclonal DEGS1 Antibody

Sign In for Pricing
View Details
Cd38 Rat Monoclonal Antibody [Clone ID: NIMR-5]
AM08041LE-N 500 µg

Cd38 Rat Monoclonal Antibody [Clone ID: NIMR-5]

Sign In for Pricing
View Details
Recombinant Streptococcus Pneumoniae rpsQ Protein (aa 1-86) (strain 70585)
VAng-Ly1864-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Pneumoniae rpsQ Protein (aa 1-86) (strain 70585)

Sign In for Pricing
View Details
Barcoded Goniometer Base B1A (40 ea)
JBS-HT-GB-B1A-40 40 Each

Barcoded Goniometer Base B1A (40 ea)

Sign In for Pricing
View Details