Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AMELY Protein

This Human AMELY Protein spans the amino acid sequence from region 17-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99218

Expression Region

17-102aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAP044
C3220-5 5 mg

XAP044

Sign In for Pricing
View Details
Fibrillin 2 (mouse) Immunizing Peptide
orb16892 100 µg

Fibrillin 2 (mouse) Immunizing Peptide

Sign In for Pricing
View Details
AIP, CT (AIP, XAP2, AH receptor-interacting protein, Aryl-hydrocarbon receptor-interacting protein, HBV X-associated protein 2, Immunophilin homolog ARA9) (MaxLight 750) discontinued
031728-ML750 100 µL

AIP, CT (AIP, XAP2, AH receptor-interacting protein, Aryl-hydrocarbon receptor-interacting protein, HBV X-associated protein 2, Immunophilin homolog ARA9) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Hsa-miR-7151-5p miRNA Antagomir
CIJ2474-01 10 nmol

Hsa-miR-7151-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-7151-5p miRNA Antagomir
CIJ2474-02 20 nmol

Hsa-miR-7151-5p miRNA Antagomir

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-rat CD3
GT06370 100 µg

PerCP/Cyanine5.5 anti-rat CD3

Sign In for Pricing
View Details