Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AMELY Protein

This Human AMELY Protein spans the amino acid sequence from region 17-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99218

Expression Region

17-102aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPACA3 Human qPCR Primer Pair (NM_173847)
HP218523 200 Reactions

SPACA3 Human qPCR Primer Pair (NM_173847)

Sign In for Pricing
View Details
Heme Oxygenase 1 (HO-1) Antibody (APC)
abx445524 100 µg

Heme Oxygenase 1 (HO-1) Antibody (APC)

Sign In for Pricing
View Details
Morin dihydrate
MBS5789988 Inquire

Morin dihydrate

Sign In for Pricing
View Details
FLNA (Filamin-A, FLN-A, Alpha-filamin, Filamin-1, Endothelial Actin-binding Protein, Actin-binding Protein 280, ABP-280, Non-muscle Filamin, FLN, FLN1) discontinued
F4510-79L 50 µg

FLNA (Filamin-A, FLN-A, Alpha-filamin, Filamin-1, Endothelial Actin-binding Protein, Actin-binding Protein 280, ABP-280, Non-muscle Filamin, FLN, FLN1) discontinued

Sign In for Pricing
View Details
Gurmarin
MBS407314-01 1 mg

Gurmarin

Sign In for Pricing
View Details
Gurmarin
MBS407314-02 5 mg

Gurmarin

Sign In for Pricing
View Details