Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsx Protein

This tsx Protein spans the amino acid sequence from region 23-294aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A928

Expression Region

23-294aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)
MBS7036327-01 0.02 mg

Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)
MBS7036327-02 0.1 mg

Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)
MBS7036327-03 5x 0.1 mg

Recombinant Arabidopsis thaliana Uncharacterized membrane protein At4g09580 (At4g09580)

Sign In for Pricing
View Details
SNX33 (Sorting Nexin-33, SH3 and PX Domain-containing Protein 3, SH3PX3, MGC32065, SH3PX3, SH3PXD3C, SNX30) (PE)
133672-PE 100 µL

SNX33 (Sorting Nexin-33, SH3 and PX Domain-containing Protein 3, SH3PX3, MGC32065, SH3PX3, SH3PXD3C, SNX30) (PE)

Sign In for Pricing
View Details
Rat PGR (Progesterone Receptor) ELISA Kit
MBS2506537-01 24 Tests (Limit 1)

Rat PGR (Progesterone Receptor) ELISA Kit

Sign In for Pricing
View Details
Rat PGR (Progesterone Receptor) ELISA Kit
MBS2506537-02 48 Tests

Rat PGR (Progesterone Receptor) ELISA Kit

Sign In for Pricing
View Details