Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Salmo salar Trypsin-1 Protein

This Salmo salar Trypsin-1 Protein spans the amino acid sequence from region 21-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Trypsin I)

UniProt

P35031

Expression Region

21-242aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Salmo salar (Atlantic salmon)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYECKAYSQTHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOPX / HOD Recombinant Rabbit monoclonal Antibody
HA751349 100 µL

HOPX / HOD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS809273 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Calcein Orange™ diacetate
22009-AAT 1 mg

Calcein Orange™ diacetate

Sign In for Pricing
View Details
ANKRD58 (SOWAHD) Human Gene Knockout Kit (CRISPR)
KN425447 1 Kit

ANKRD58 (SOWAHD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLEC1B Human Gene Knockout Kit (CRISPR)
KN417091 1 Kit

CLEC1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648950 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details