Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD81 Protein

This Human CD81 Protein spans the amino acid sequence from region 113-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

26 kDa cell surface protein TAPA-1 (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD_antigen, CD81) (TAPA1) (TSPAN28)

UniProt

P60033

Expression Region

113-201aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dbx1 (Homeobox Protein DBX1, Developing Brain Homeobox Protein 1, Dbx1, Dbx) (APC)
MBS6455415-01 0.2 mL

Dbx1 (Homeobox Protein DBX1, Developing Brain Homeobox Protein 1, Dbx1, Dbx) (APC)

Sign In for Pricing
View Details
Dbx1 (Homeobox Protein DBX1, Developing Brain Homeobox Protein 1, Dbx1, Dbx) (APC)
MBS6455415-02 5x 0.2 mL

Dbx1 (Homeobox Protein DBX1, Developing Brain Homeobox Protein 1, Dbx1, Dbx) (APC)

Sign In for Pricing
View Details
Lentiviral human SELENOH shRNA (UAS) - Lentiviral human SELENOH shRNA (UAS, GFP) (100)
GTR15080193 1 Vial

Lentiviral human SELENOH shRNA (UAS) - Lentiviral human SELENOH shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
COBRA1 Protein Vector (Rat) (pPM-C-HA)
PV260988 500 ng

COBRA1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ValidElisa Kit
EK340893 96 Well

Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ValidElisa Kit

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Glutamyl-tRNA reductase (hemA)
MBS1177454-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 18 Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details