Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD81 Protein

This Human CD81 Protein spans the amino acid sequence from region 113-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

26 kDa cell surface protein TAPA-1 (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD_antigen, CD81) (TAPA1) (TSPAN28)

UniProt

P60033

Expression Region

113-201aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF1R Antibody
orb1174062-01 10 µg

CSF1R Antibody

Sign In for Pricing
View Details
CSF1R Antibody
orb1174062-02 50 µg

CSF1R Antibody

Sign In for Pricing
View Details
CSF1R Antibody
orb1174062-03 100 µg

CSF1R Antibody

Sign In for Pricing
View Details
CSF1R Antibody
orb1174062-04 500 µg

CSF1R Antibody

Sign In for Pricing
View Details
Anti-LRRK2 Rabbit pAb
GB112447-50 50 μL

Anti-LRRK2 Rabbit pAb

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2045729-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details