Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAM4 Protein

This CAM4 Protein spans the amino acid sequence from region 1-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CaM-4)

UniProt

P0DH96

Expression Region

1-149aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP12 polyclonal antibody
BS71385-01 50 µL

TRIP12 polyclonal antibody

Sign In for Pricing
View Details
TRIP12 polyclonal antibody
BS71385-02 100 µL

TRIP12 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae PUS2 Protein (aa 1-370) [His]
VAng-Wyb5391-1mg 1 mg

Recombinant Saccharomyces Cerevisiae PUS2 Protein (aa 1-370) [His]

Sign In for Pricing
View Details
ALDH2 polyclonal antibody
orb669797-01 50 μL

ALDH2 polyclonal antibody

Sign In for Pricing
View Details
ALDH2 polyclonal antibody
orb669797-02 100 µL

ALDH2 polyclonal antibody

Sign In for Pricing
View Details
ALDH2 polyclonal antibody
orb669797-03 200 µL

ALDH2 polyclonal antibody

Sign In for Pricing
View Details