Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FGF2 Protein

This Bovine FGF2 Protein spans the amino acid sequence from region 10-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

UniProt

P03969

Expression Region

10-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C14ORF21 (NOP9) activation kit by CRISPRa
GA116024 1 Kit

Human C14ORF21 (NOP9) activation kit by CRISPRa

Sign In for Pricing
View Details
CHMP4A (NM_014169) Human Recombinant Protein
TP322002M 100 µg

CHMP4A (NM_014169) Human Recombinant Protein

Sign In for Pricing
View Details
Valproic Acid Ethyl Ester
TRC-V094770-500MG 500 mg

Valproic Acid Ethyl Ester

Sign In for Pricing
View Details
COMMD9 Antibody
KC-48324-01 50 μL

COMMD9 Antibody

Sign In for Pricing
View Details
COMMD9 Antibody
KC-48324-02 100 µL

COMMD9 Antibody

Sign In for Pricing
View Details
COMMD9 Antibody
KC-48324-03 1 mL

COMMD9 Antibody

Sign In for Pricing
View Details