Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GKN1 Protein

This Human GKN1 Protein spans the amino acid sequence from region 35-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)

UniProt

Q9NS71

Expression Region

35-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS Polyclonal Antibody
E-AB-19068-01 20 µL

SARS Polyclonal Antibody

Sign In for Pricing
View Details
SARS Polyclonal Antibody
E-AB-19068-02 60 µL

SARS Polyclonal Antibody

Sign In for Pricing
View Details
SARS Polyclonal Antibody
E-AB-19068-03 120 µL

SARS Polyclonal Antibody

Sign In for Pricing
View Details
SARS Polyclonal Antibody
E-AB-19068-04 200 µL

SARS Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD370 (1F6) In Vivo Antibody - Low Endotoxin
ICH1168-100mg 100 mg

Anti-Mouse CD370 (1F6) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Human PPFIA3 activation kit by CRISPRa
GA105655 1 Kit

Human PPFIA3 activation kit by CRISPRa

Sign In for Pricing
View Details