Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GKN1 Protein

This Human GKN1 Protein spans the amino acid sequence from region 35-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)

UniProt

Q9NS71

Expression Region

35-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Amino-1,3-dibutyl-5-nitroso-2,4(1H,3H)-pyrimidinedione
TRC-A604620-250MG 250 mg

6-Amino-1,3-dibutyl-5-nitroso-2,4(1H,3H)-pyrimidinedione

Sign In for Pricing
View Details
MYBPC1 (NM_206821) Human Over-expression Lysate
LC404225 20 µg

MYBPC1 (NM_206821) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL
BNC940499-500 1x 500 µL

Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTSF1 (Center) Rabbit Polyclonal Antibody
AP51982PU-N 400 µL

GTSF1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF488A conjugate, 0.1mg/mL
BNC880833-500 1x 500 µL

Calponin-1 (CALP + CNN1/832), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SV2A Recombinant Rabbit monoclonal Antibody
HA723233 100 µL

SV2A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details