Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARAP Protein

This Human GABARAP Protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GABA (A) receptor-associated protein, MM46

UniProt

O95166

Expression Region

1-116aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF568 conjugate, 0.1mg/mL
BNC683632-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), Biotin conjugate, 0.1mg/mL
BNCB0424-100 1x 100 µL

CD147 (8D6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Copper Powder
TRC-C685340-500MG 500 mg

Copper Powder

Sign In for Pricing
View Details
2,3-Dibromo-3-(2-bromophenyl)propionic Acid
TRC-D425115-2G 2 g

2,3-Dibromo-3-(2-bromophenyl)propionic Acid

Sign In for Pricing
View Details
TB 500
TRC-T010205-2.5MG 2.5 mg

TB 500

Sign In for Pricing
View Details
Beta Tubulin Monoclonal Antibody
AN005310L-01 25 µL

Beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details