Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARAP Protein

This Human GABARAP Protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GABA (A) receptor-associated protein, MM46

UniProt

O95166

Expression Region

1-116aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prr29 shRNA (UAS) - Lentiviral mouse Prr29 shRNA (UAS, RFP) (100)
GTR15268836 1 Vial

Lentiviral mouse Prr29 shRNA (UAS) - Lentiviral mouse Prr29 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Sambucus nigra Lectin (SNA/EBL I) - Alexa Fluor 647
21511555-1 1 mg

Sambucus nigra Lectin (SNA/EBL I) - Alexa Fluor 647

Sign In for Pricing
View Details
Bcl-2 (B Cell Leukemia 2) (BSA, Preservative Free)
B0807-06E2 100 µg

Bcl-2 (B Cell Leukemia 2) (BSA, Preservative Free)

Sign In for Pricing
View Details
Human SKA2 qPCR Primer Pair
QH74121S 200 Tests

Human SKA2 qPCR Primer Pair

Sign In for Pricing
View Details
CD40L antibody
10-7890 1 mg

CD40L antibody

Sign In for Pricing
View Details
DGCR6L Knockout HT29 Polyclonal Cells
ARG14570 1 Million

DGCR6L Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details