Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAR Protein

This Human ADAR Protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

136 kDa double-stranded RNA-binding protein (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP) (ADAR1) (DSRAD) (G1P1) (IFI4) (DRADA)

UniProt

P55265

Expression Region

1-176aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calcitonin Gene Related Peptide (CGRP) ELISA Kit
DLR-CGRP-Hu-96T 96 Tests

Human Calcitonin Gene Related Peptide (CGRP) ELISA Kit

Sign In for Pricing
View Details
DC SIGN (CD209) Mouse Monoclonal Antibody [Clone ID: 5D7]
TA319909 100 µg

DC SIGN (CD209) Mouse Monoclonal Antibody [Clone ID: 5D7]

Sign In for Pricing
View Details
Crisp4 (Crisp1) (NM_001039393) Rat Tagged ORF Clone Lentiviral Particle
RR215461L3V 200 µL

Crisp4 (Crisp1) (NM_001039393) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Slc1a6 Mouse qPCR Primer Pair (NM_009200)
MP215640 200 Reactions

Slc1a6 Mouse qPCR Primer Pair (NM_009200)

Sign In for Pricing
View Details
Porcine Interleukin 16 (IL16) ELISA Kit
RDR-IL16-p-01 96 Tests

Porcine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 16 (IL16) ELISA Kit
RDR-IL16-p-02 48 Tests

Porcine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details