Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GKN1 Protein

This Human GKN1 Protein spans the amino acid sequence from region 35-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)

UniProt

Q9NS71

Expression Region

35-199aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Butyrate-d3
164104 1 mg

Ethyl Butyrate-d3

Sign In for Pricing
View Details
Lentiviral mouse Cckbr shRNA (UAS) - Lentiviral mouse Cckbr shRNA (UAS, RFP) plasmid
GTR15299488 1 Vial

Lentiviral mouse Cckbr shRNA (UAS) - Lentiviral mouse Cckbr shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-2, RPS6KA2, S6K-alpha-2, S6K-alpha2) (MaxLight 650)
132866-ML650 100 µL

RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-2, RPS6KA2, S6K-alpha-2, S6K-alpha2) (MaxLight 650)

Sign In for Pricing
View Details
Human Protein Wnt-3a, WNT3A ELISA Kit
MBS941338-01 24 Well (LIMIT 1)

Human Protein Wnt-3a, WNT3A ELISA Kit

Sign In for Pricing
View Details
Human Protein Wnt-3a, WNT3A ELISA Kit
MBS941338-02 48 Well

Human Protein Wnt-3a, WNT3A ELISA Kit

Sign In for Pricing
View Details
Human Protein Wnt-3a, WNT3A ELISA Kit
MBS941338-03 96 Well

Human Protein Wnt-3a, WNT3A ELISA Kit

Sign In for Pricing
View Details