Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNNC1 Protein

This Human TNNC1 Protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TN-C)

UniProt

P63316

Expression Region

1-161aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SILV/PMEL Antibody Picoband®, Dylight594 Conjugate
A01262-3-Dylight594 100 µg

Anti-SILV/PMEL Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Human Biotinylated PSGL-1 / CD162 Recombinant Protein His Tag and Avi Tag Lyophilized 25UG
IHUBTNYLPSGL1CD162RHISAVILY25UG 25 µg

Human Biotinylated PSGL-1 / CD162 Recombinant Protein His Tag and Avi Tag Lyophilized 25UG

Sign In for Pricing
View Details
ZNF146 Polyclonal Antibody, HRP Conjugated
bs-6755R-HRP 100 µL

ZNF146 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
2- (3- ((t-Butyldimethylsilyl) oxy) butoxy) acetic Acid
413330 50 mg

2- (3- ((t-Butyldimethylsilyl) oxy) butoxy) acetic Acid

Sign In for Pricing
View Details
Anti-XIAP (Phospho-S87) Antibody
CPA7138-01 30 µL

Anti-XIAP (Phospho-S87) Antibody

Sign In for Pricing
View Details
Anti-XIAP (Phospho-S87) Antibody
CPA7138-02 50 μL

Anti-XIAP (Phospho-S87) Antibody

Sign In for Pricing
View Details