Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP1 Protein

This Human CASP1 Protein spans the amino acid sequence from region 1-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CASP-1) (Interleukin-1 beta convertase) (IL-1BC) (Interleukin-1 beta-converting enzyme) (ICE) (IL-1 beta-converting enzyme) (p45)

UniProt

P29466

Expression Region

1-91aa

Tag

C-terminal HA-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAX2 discontinued
543683-01 30ul

VAX2 discontinued

Sign In for Pricing
View Details
VAX2 discontinued
543683-02 100 µL

VAX2 discontinued

Sign In for Pricing
View Details
Pesticide Std Toxaphene (Camphechlor) Neat - 10MG
REPET170N 10 mg

Pesticide Std Toxaphene (Camphechlor) Neat - 10MG

Sign In for Pricing
View Details
Recombinant Sheep Ribonuclease pancreatic (RNASE1)
MBS964073-01 0.02 mg (E-Coli)

Recombinant Sheep Ribonuclease pancreatic (RNASE1)

Sign In for Pricing
View Details
Recombinant Sheep Ribonuclease pancreatic (RNASE1)
MBS964073-02 0.1 mg (E-Coli)

Recombinant Sheep Ribonuclease pancreatic (RNASE1)

Sign In for Pricing
View Details
Recombinant Sheep Ribonuclease pancreatic (RNASE1)
MBS964073-03 0.02 mg (Yeast)

Recombinant Sheep Ribonuclease pancreatic (RNASE1)

Sign In for Pricing
View Details