Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP1 Protein

This Human CASP1 Protein spans the amino acid sequence from region 1-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CASP-1) (Interleukin-1 beta convertase) (IL-1BC) (Interleukin-1 beta-converting enzyme) (ICE) (IL-1 beta-converting enzyme) (p45)

UniProt

P29466

Expression Region

1-91aa

Tag

C-terminal HA-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-216b miRNA Inhibitor
MIH01566 2x 5.0 nmol

hsa-miR-216b miRNA Inhibitor

Sign In for Pricing
View Details
MEIS2 Rabbit Polyclonal Antibody (FITC)
orb2134552 100 µL

MEIS2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit OGP (Osteogenic Growth Peptide) ValidElisa Kit
EK347248 96 Well

Rabbit OGP (Osteogenic Growth Peptide) ValidElisa Kit

Sign In for Pricing
View Details
NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9, Enhancer of Filamentation 1)
486731 100 µL

NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9, Enhancer of Filamentation 1)

Sign In for Pricing
View Details
DYNLT3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV791498 1.0 µg DNA

DYNLT3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-CD58 Antibody-FITC labled
MBS8236188-01 50 Assays

Anti-CD58 Antibody-FITC labled

Sign In for Pricing
View Details