Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine DCN Protein

This Bovine DCN Protein spans the amino acid sequence from region 31-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Bone proteoglycan II) (PG-S2)

UniProt

P21793

Expression Region

31-360aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria Gonorrhoeae bioF Protein (aa 1-380) (strain ATCC 700825 / FA 1090)
VAng-Wyb2478-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae bioF Protein (aa 1-380) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
GATB Antibody - N-terminal region : FITC (ARP71361_P050-FITC)
ARP71361_P050-FITC 100 µL

GATB Antibody - N-terminal region : FITC (ARP71361_P050-FITC)

Sign In for Pricing
View Details
KPTN (Kaptin, 2E4, MRT41) (FITC)
MBS6424156-01 0.1 mL

KPTN (Kaptin, 2E4, MRT41) (FITC)

Sign In for Pricing
View Details
KPTN (Kaptin, 2E4, MRT41) (FITC)
MBS6424156-02 5x 0.1 mL

KPTN (Kaptin, 2E4, MRT41) (FITC)

Sign In for Pricing
View Details
UCP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2581707 1.0 µg DNA

UCP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GAD1 Peptide - N-terminal region
MBS3236566-01 0.1 mg

GAD1 Peptide - N-terminal region

Sign In for Pricing
View Details