Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S100B Protein

This Bovine S100B Protein spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)

UniProt

P02638

Expression Region

2-92aa

Tag

N-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGCG CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43623154 3x 1.0 µg DNA

SGCG CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Chlamydia trachomatis LPS discontinued
C4250-03D 1 mg

Chlamydia trachomatis LPS discontinued

Sign In for Pricing
View Details
TTC27-set siRNA/shRNA/RNAi Lentivector (Human)
48677091 4x 500 ng

TTC27-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CD46 Antibody
V2700-20UG 20 µg

CD46 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MAP7D2 Antibody [DyLight 755]
NBP2-97908IR 0.1 mL

Rabbit Polyclonal MAP7D2 Antibody [DyLight 755]

Sign In for Pricing
View Details
Monoclonal LILRA3 Antibody (monoclonal) (M01), Clone: 2E10
AMM03737G 0.1mg

Monoclonal LILRA3 Antibody (monoclonal) (M01), Clone: 2E10

Sign In for Pricing
View Details