Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANK3 Protein

This Human ANK3 Protein spans the amino acid sequence from region 4088-4199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ANK-3) (Ankyrin-G)

UniProt

Q12955

Expression Region

4088-4199aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu IgG (Fab) Purified
11-319-C100 0.1 mg

Anti-Hu IgG (Fab) Purified

Sign In for Pricing
View Details
PAX3 Antibody / Paired box protein Pax-3
FY13236 100 µg

PAX3 Antibody / Paired box protein Pax-3

Sign In for Pricing
View Details
GENLISA™ Human KAL (Kallistatin) ELISA
KBH21343 96 Well

GENLISA™ Human KAL (Kallistatin) ELISA

Sign In for Pricing
View Details
Anti-RPL26L1 Rabbit pAb
GB112028-100 100 μL

Anti-RPL26L1 Rabbit pAb

Sign In for Pricing
View Details
Cytochrome p450 2J2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-14181R-BF647 100 µL

Cytochrome p450 2J2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Sheep Leptin (LEP) ELISA Kit
orb782125-01 48 Tests

Sheep Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details