Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Slc25a18 Protein

This Rat Slc25a18 Protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GC-2) (Glutamate/H (+) symporter 2) (Solute carrier family 25 member 18)

UniProt

Q505J6

Expression Region

1-320aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE-

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAGEA12 activation kit by CRISPRa
GA102795 1 Kit

Human MAGEA12 activation kit by CRISPRa

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-01 24 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-02 48 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit
E-OSEL-M0013-03 96 Tests

QuicKey Pro Mouse IgG1 (Immunoglobulin G1) ELISA Kit

Sign In for Pricing
View Details
N-Nitroso Enzalutamide Cyanoamide
TRC-N630890-100MG 100 mg

N-Nitroso Enzalutamide Cyanoamide

Sign In for Pricing
View Details
Adrenalone
TRC-A305095-10G 10 g

Adrenalone

Sign In for Pricing
View Details