Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGF Protein

This Human NGF Protein spans the amino acid sequence from region 122-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Beta-NGF)

UniProt

P01138

Expression Region

122-241aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE (Phospho-Ser498) Antibody
orb614166-01 50 μL

BACE (Phospho-Ser498) Antibody

Sign In for Pricing
View Details
BACE (Phospho-Ser498) Antibody
orb614166-02 100 µL

BACE (Phospho-Ser498) Antibody

Sign In for Pricing
View Details
REXO1L1 (REXO1L1P) (NM_172239) Human Over-expression Lysate
LS254958-20ug 20 µg

REXO1L1 (REXO1L1P) (NM_172239) Human Over-expression Lysate

Sign In for Pricing
View Details
GENLISA Canine HAMP (Hepcidin) ELISA
KLN01037 1x 96 Well

GENLISA Canine HAMP (Hepcidin) ELISA

Sign In for Pricing
View Details
Recombinant Streptococcus sanguinis Histidinol-phosphate aminotransferase (hisC)
MBS1211647-01 0.02 mg (E-Coli)

Recombinant Streptococcus sanguinis Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Streptococcus sanguinis Histidinol-phosphate aminotransferase (hisC)
MBS1211647-02 0.02 mg (Yeast)

Recombinant Streptococcus sanguinis Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details