Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Prorelaxin Protein

This Dog Prorelaxin Protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9TRM8

Expression Region

26-177aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone Deacetylase (HDAC) Activity Fluorometric Assay Kit
E-BC-F051 96 T (40 samples)

Histone Deacetylase (HDAC) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
CENPC Rabbit Polyclonal Antibody
TA374634 100 µL

CENPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Alox12e activation kit by CRISPRa
GA200166 1 Kit

Mouse Alox12e activation kit by CRISPRa

Sign In for Pricing
View Details
Tnfrsf1a Rat Monoclonal Antibody [Clone ID: HM104]
CL044R 50 µg

Tnfrsf1a Rat Monoclonal Antibody [Clone ID: HM104]

Sign In for Pricing
View Details
D-LAP5.Na
SIH-414-10MG 10 mg

D-LAP5.Na

Sign In for Pricing
View Details
S100A4 Polyclonal Antibody
E-AB-70283-01 60 µL

S100A4 Polyclonal Antibody

Sign In for Pricing
View Details