Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Prorelaxin Protein

This Dog Prorelaxin Protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9TRM8

Expression Region

26-177aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLIT2, Tag Free
HA211214-01 20 µg

Human SLIT2, Tag Free

Sign In for Pricing
View Details
Human SLIT2, Tag Free
HA211214-02 50 µg

Human SLIT2, Tag Free

Sign In for Pricing
View Details
Human SLIT2, Tag Free
HA211214-03 100 µg

Human SLIT2, Tag Free

Sign In for Pricing
View Details
PRKAG2 (NM_001040633) Human Over-expression Lysate
LY421790 100 µg

PRKAG2 (NM_001040633) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF488A conjugate, 0.1mg/mL
BNC881130-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705008 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details