Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine TGFB2 Protein

This Bovine TGFB2 Protein spans the amino acid sequence from region 303-414aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF)

UniProt

P21214

Expression Region

303-414aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7 siRNA (m)
sc-35547 10 µM

HDAC7 siRNA (m)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2, soluble (sTNFR-II), Recombinant, Human discontinued
T9162-73A 10 µg

Tumor Necrosis Factor Receptor 2, soluble (sTNFR-II), Recombinant, Human discontinued

Sign In for Pricing
View Details
CES1P1 Human shRNA Plasmid Kit (Locus ID 51716)
TR319877 1 Kit

CES1P1 Human shRNA Plasmid Kit (Locus ID 51716)

Sign In for Pricing
View Details
Recombinant Human ARF GAP GIT1 (C-His)
32-10688-500 500 µg

Recombinant Human ARF GAP GIT1 (C-His)

Sign In for Pricing
View Details
PDE11A antibody - C-terminal region
MBS3216277-01 0.1 mL

PDE11A antibody - C-terminal region

Sign In for Pricing
View Details
PDE11A antibody - C-terminal region
MBS3216277-02 5x 0.1 mL

PDE11A antibody - C-terminal region

Sign In for Pricing
View Details