Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine TGFB2 Protein

This Bovine TGFB2 Protein spans the amino acid sequence from region 303-414aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF)

UniProt

P21214

Expression Region

303-414aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SART3 Antibody Picoband® Fluoro647 Conjugated
A03973-2-Fluoro647 100 µg/Vial

Anti-SART3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
TPD52L1 / D53 Immunizing Peptide
orb50288 100 µg

TPD52L1 / D53 Immunizing Peptide

Sign In for Pricing
View Details
PICALM Recombinant Protein (Mouse)
RP161984 100 µg

PICALM Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Vat1l (NM_173016) Mouse Recombinant Protein
TP506602 20 µg

Vat1l (NM_173016) Mouse Recombinant Protein

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-148a-5p Vector
mm30142 500 ng

LentimiRa-Off-mmu-miR-148a-5p Vector

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) nei Polyclonal Antibody
MBS9002963 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) nei Polyclonal Antibody

Sign In for Pricing
View Details