Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CALR Protein

This Human CALR Protein spans the amino acid sequence from region 177-417aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)

UniProt

P27797

Expression Region

177-417aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A Polyclonal Antibody
E44H01748 100 µL

Cyclin A Polyclonal Antibody

Sign In for Pricing
View Details
Trim12a Protein Lysate (Mouse) with C-HA Tag
47745034 100 µg

Trim12a Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human FBXO45 Knockout A549 cell line
GTR15420149 1 Vial

Human FBXO45 Knockout A549 cell line

Sign In for Pricing
View Details
Lentiviral human CACNA1A shRNA (UAS) - Lentiviral human CACNA1A shRNA (UAS, GFP) (100)
GTR15296604 1 Vial

Lentiviral human CACNA1A shRNA (UAS) - Lentiviral human CACNA1A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human LEPR (Leptin Receptor) ELISA Kit
EKE60087-01 96 Tests

Human LEPR (Leptin Receptor) ELISA Kit

Sign In for Pricing
View Details
Human LEPR (Leptin Receptor) ELISA Kit
EKE60087-02 5x 96 Tests

Human LEPR (Leptin Receptor) ELISA Kit

Sign In for Pricing
View Details