Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM5 Protein

This Human CEACAM5 Protein spans the amino acid sequence from region 35-685aa (E398K) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Carcinoembryonic antigen) (CEA) (Meconium antigen 100) (CD antigen CD66e)

UniProt

P06731

Expression Region

35-685aa (E398K)

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody, the EC50 is 0.8955-1.719 ng/mL.

Form

Lyophilized powder

Molecular Weight

74.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGT5 Protein Vector (Mouse) (pPB-C-His)
PV181862 500 ng

GGT5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (MaxLight 550)
244191-ML550 100 µL

CAMK2D (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, DKFZp686G23119, DKFZp686I2288, MGC44911) (MaxLight 550)

Sign In for Pricing
View Details
TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (AP)
MBS6396841-01 0.1 mL

TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (AP)

Sign In for Pricing
View Details
TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (AP)
MBS6396841-02 5x 0.1 mL

TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (AP)

Sign In for Pricing
View Details
Thyroid Peroxidase antibody
10-7972 1 mg

Thyroid Peroxidase antibody

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbE (pcbE)
MBS7025405-01 0.02 mg

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbE (pcbE)

Sign In for Pricing
View Details