Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Blood group Rh (CE) polypeptide (RHCE), partial

Product Specifications

Product Name Alternative

Rh polypeptide 1 (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens)

Abbreviation

Recombinant Human RHCE protein, partial

Gene Name

RHCE

UniProt

P18577

Expression Region

379-417aa

Organism

Homo sapiens (Human)

Target Sequence

TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)
MBS6400303-01 0.1 mL

CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)

Sign In for Pricing
View Details
CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)
MBS6400303-02 5x 0.1 mL

CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)

Sign In for Pricing
View Details
Barium Chloride Dihydrate 99% Extrapure
0337A 01000 1 Kg

Barium Chloride Dihydrate 99% Extrapure

Sign In for Pricing
View Details
Zfp708 ORF Vector (Mouse) (pORF)
ORF062522 1.0 µg DNA

Zfp708 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303) (MaxLight 650)
MBS6222468-01 0.1 mL

GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303) (MaxLight 650)

Sign In for Pricing
View Details
GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303) (MaxLight 650)
MBS6222468-02 5x 0.1 mL

GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303) (MaxLight 650)

Sign In for Pricing
View Details