Human Acrp30 Protein
Recombinant of human Acrp30 protein
Product Specifications
Product Name Alternative
Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Source
Escherichia Coli
Purity
Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Form
Sterile Filtered clear solution.
Storage Conditions
Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.
AA Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
