Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Acrp30 Protein

Recombinant of human Acrp30 protein

Product Specifications

Product Name Alternative

Acrp30, AdipoQ, GBP-28, APM-1, ACDC.

Source

Escherichia Coli

Purity

Acrp30 purity is greater than 90% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

AA Sequence

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti alpaca IgG rabbit pAb
MBS8601890-01 0.1 mL

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details
Rabbit anti alpaca IgG rabbit pAb
MBS8601890-02 0.1 mL (AF405L)

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details
Rabbit anti alpaca IgG rabbit pAb
MBS8601890-03 0.1 mL (AF405S)

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details
Rabbit anti alpaca IgG rabbit pAb
MBS8601890-04 0.1 mL (AF610)

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details
Rabbit anti alpaca IgG rabbit pAb
MBS8601890-05 0.1 mL (AF635)

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details
Rabbit anti alpaca IgG rabbit pAb
MBS8601890-06 0.1 mL (APC)

Rabbit anti alpaca IgG rabbit pAb

Sign In for Pricing
View Details