Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LGALS7 Protein

Recombinant of human LGALS7 protein

Product Specifications

Product Name Alternative

Galectin-7, Gal-7, HKL-14, PI7, p53-induced gene 1 protein, LGALS7, PIG1, LGALS7B, GAL7, LGALS7A.

Source

Escherichia Coli

Field of Research

Cell Biology

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Galectin-7 in sterile distilled H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized LGALS7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Galectin-7 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

LGALS7 was lyophilized from a concentrated (1mg/ml) solution in 20mM Tris, 150mM NaCl, 1mM EDTA and 5% Trehalose, pH 8.

AA Sequence

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GWB-HG4389-1MG - Rubella Antigen (HPV-77) Native Protein
GWB-HG4389-1MG 1 mg

GWB-HG4389-1MG - Rubella Antigen (HPV-77) Native Protein

Sign In for Pricing
View Details
Rat Leukotriene C4 (LTC4) ELISA Kit
EIA05990r 1 Kit

Rat Leukotriene C4 (LTC4) ELISA Kit

Sign In for Pricing
View Details
Human GXYLT2 qPCR Primer Pair
QH81813S 200 Tests

Human GXYLT2 qPCR Primer Pair

Sign In for Pricing
View Details
MLPH Polyclonal Antibody
ANT-13207-100ug 100 µg

MLPH Polyclonal Antibody

Sign In for Pricing
View Details
2-{6-[ (tert-Butoxy) carbonyl]-6-azaspiro[3.4]octan-7-yl}acetic acid
TMD06455-01 50 mg

2-{6-[ (tert-Butoxy) carbonyl]-6-azaspiro[3.4]octan-7-yl}acetic acid

Sign In for Pricing
View Details
2-{6-[ (tert-Butoxy) carbonyl]-6-azaspiro[3.4]octan-7-yl}acetic acid
TMD06455-02 0.5 g

2-{6-[ (tert-Butoxy) carbonyl]-6-azaspiro[3.4]octan-7-yl}acetic acid

Sign In for Pricing
View Details