Zebrafish GH Protein
Recombinant of Zebrafish GH protein
Product Specifications
Product Name Alternative
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Source
Escherichia Coli
Purity
Greater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Zebrafish Growth-Hormone in 0.4% NaHCO3 or water adjusted to pH-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Storage Conditions
Stability: Lyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3 pH-8.
AA Sequence
AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-LTBP2-Hu-96Tests 96 Tests
Human Latent Transforming Growth Factor Beta Binding Protein 2 (LTBP2) ELISA Kit
Sign In for Pricing
View Details 
LV750419 1.0 µg DNA
THRB-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 