What is the catalog number for Zebrafish GH Protein?

The catalog number for Zebrafish GH Protein is orb80369.

What sizes are available for Zebrafish GH Protein?

Zebrafish GH Protein is available in the following size(s): 10 µg, 50 µg, 1 mg.

How many pack sizes does Zebrafish GH Protein come in?

Zebrafish GH Protein is available in 3 different pack sizes.

Is Zebrafish GH Protein in stock?

Zebrafish GH Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Zebrafish GH Protein

Recombinant of Zebrafish GH protein

Product Specifications

Product Name Alternative

GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.

Source

Escherichia Coli

Purity

Greater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Zebrafish Growth-Hormone in 0.4% NaHCO3 or water adjusted to pH-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

Storage Conditions

Stability: Lyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3 pH-8.

AA Sequence

AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL