Human IGFBP 3 Protein
Recombinant of human IGFBP 3 protein
Product Specifications
Product Name Alternative
GH-dependant binding protein, IBP3, BP-53, IGFBP-3.
Source
Escherichia Coli
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The ED50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 x 103 IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
Lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.
AA Sequence
GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1755004 1.0 µg DNA
PTPMT1 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 128296-AP 100 µL
IFNAR1 (Interferon alpha/beta Receptor 1, IFN-R-1, IFN-alpha/beta Receptor 1, Cytokine Receptor Class-II Member 1, Cytokine Receptor Family 2 Member 1, CRF2-1, Type I Interferon Receptor 1, IFNAR) (AP) discontinued
Sign In for Pricing
View Details