What is the catalog number for Human IGFBP 3 Protein?

The catalog number for Human IGFBP 3 Protein is orb426394.

What sizes are available for Human IGFBP 3 Protein?

Human IGFBP 3 Protein is available in the following size(s): 5 µg, 25 µg, 1 mg.

How many pack sizes does Human IGFBP 3 Protein come in?

Human IGFBP 3 Protein is available in 3 different pack sizes.

Is Human IGFBP 3 Protein in stock?

Human IGFBP 3 Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IGFBP 3 Protein

Recombinant of human IGFBP 3 protein

Product Specifications

Product Name Alternative

GH-dependant binding protein, IBP3, BP-53, IGFBP-3.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 x 103 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.

AA Sequence

GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK