Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGFBP 3 Protein

Recombinant of human IGFBP 3 protein

Product Specifications

Product Name Alternative

GH-dependant binding protein, IBP3, BP-53, IGFBP-3.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The ED50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 x 103 IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.

AA Sequence

GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI2 Antibody - N-terminal region : HRP (ARP58241_P050-HRP)
ARP58241_P050-HRP 100 µL

TFPI2 Antibody - N-terminal region : HRP (ARP58241_P050-HRP)

Sign In for Pricing
View Details
Recombinant Human STAM Protein, N-His
HV386012-01 50 µg

Recombinant Human STAM Protein, N-His

Sign In for Pricing
View Details
Recombinant Human STAM Protein, N-His
HV386012-02 100 µg

Recombinant Human STAM Protein, N-His

Sign In for Pricing
View Details
Recombinant Human STAM Protein, N-His
HV386012-03 1 mg

Recombinant Human STAM Protein, N-His

Sign In for Pricing
View Details
rno-miR-322-5p miRNA Agomir
MBS8315366-01 5 nmol

rno-miR-322-5p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-322-5p miRNA Agomir
MBS8315366-02 10 nmol

rno-miR-322-5p miRNA Agomir

Sign In for Pricing
View Details