What is the catalog number for Human TNFR2 Protein (His Tag)?

The catalog number for Human TNFR2 Protein (His Tag) is orb80625.

What sizes are available for Human TNFR2 Protein (His Tag)?

Human TNFR2 Protein (His Tag) is available in the following size(s): 5 µg, 20 µg, 1 mg.

How many pack sizes does Human TNFR2 Protein (His Tag) come in?

Human TNFR2 Protein (His Tag) is available in 3 different pack sizes.

Is Human TNFR2 Protein (His Tag) in stock?

Human TNFR2 Protein (His Tag) is currently made to order / not held in immediate stock. Contact us for lead time.

Human TNFR2 Protein (His Tag)

Recombinant of Human TNFR2 protein (His Tag)

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 1B, Tumor necrosis factor receptor 2, Tumor necrosis factor receptor type II, p75, p80 TNF-alpha receptor, CD120b, Etanercept, TNF-R2, TNF-RII, TNFR-II, TNFRSF1B, TNFBR, TNFR2, TBPII, TNFR2, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II.

Source

Escherichia Coli

Field of Research

Cell Biology

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.

AA Sequence

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT