Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFR1 Protein

Recombinant of human FGFR1 protein

Product Specifications

Product Name Alternative

FGFR-1, bFGF-R, C-FGR, CD331, fms-related tyrosine kinase 2, Pfeiffer syndrome, CEK, FLG, FLT2, KAL2, BFGFR, FGFBR, HBGFR, FGFR1/FGFR1OP2 FUSION GENE, FGFR1/ZNF198 FUSION GENE, FLG FGFR1/BCR FUSION GENE, FLG protein, FMS-LIKE GENE, N-sam tyrosine kinase, basic fibroblast growth factor receptor 1.

Source

Insect Cells

Field of Research

Signal Transduction

Purity

Greater than 90.0% as determined by SDS-PAGE.

Bioactivity

Determined by its ability to inhibit human FGF acidic-dependent proliferation on R1 cells. The ED50 for this effect is typically at 15.0-30.0 ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized bFGF-R in sterile PBS not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized FGFR1A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGFR1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein Kinases

Preservative

CD331 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.

AA Sequence

RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQL AESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSS EDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFK CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYT CIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYS DPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSF EDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEDPRRASIEG RGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KChIP2b K+ channel Antibody (K60/87)
MBS1571947-01 0.1 mg

Anti-KChIP2b K+ channel Antibody (K60/87)

Sign In for Pricing
View Details
Anti-KChIP2b K+ channel Antibody (K60/87)
MBS1571947-02 1 mg

Anti-KChIP2b K+ channel Antibody (K60/87)

Sign In for Pricing
View Details
Anti-KChIP2b K+ channel Antibody (K60/87)
MBS1571947-03 5x 1 mg

Anti-KChIP2b K+ channel Antibody (K60/87)

Sign In for Pricing
View Details
Caspase 8 (Caspase-8, CASP-8, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/Ced-3-like Protease, FADD-like ICE, FLICE, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5) discontinued
215254 100 µg

Caspase 8 (Caspase-8, CASP-8, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/Ced-3-like Protease, FADD-like ICE, FLICE, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5) discontinued

Sign In for Pricing
View Details
Lentiviral human EXOC3 shRNA (UAS) - Lentiviral human EXOC3 shRNA (UAS, GFP) (25)
GTR15093092 1 Vial

Lentiviral human EXOC3 shRNA (UAS) - Lentiviral human EXOC3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SFRS3 antibody
70R-4718 100 µL

SFRS3 antibody

Sign In for Pricing
View Details