Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantM-CSF, Rat

Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells [2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4].

Product Specifications

Product Name Alternative

Macrophage Colony Stimulating Factor, CSF-1, Lanimostim, MCSF, M-CSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 4x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

32-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80 °C from date of receipt. Upon reconstitution, rrM-CSF should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQ ELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprisil C18-IP HPLC Column, 5 µm, 100 Å, CD555-C18-IP x 200 mm
CD555-C18-IP 5 µm

Caprisil C18-IP HPLC Column, 5 µm, 100 Å, CD555-C18-IP x 200 mm

Sign In for Pricing
View Details
ZNF365 Rabbit pAb, IRDye 800CW conjugated
orb2845605 100 µL

ZNF365 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Lentiviral human VWF shRNA (UAS) - Lentiviral human VWF shRNA (UAS, iRFP) (100)
GTR15335070 1 Vial

Lentiviral human VWF shRNA (UAS) - Lentiviral human VWF shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MSin3A/SIN3A Rabbit Polyclonal Antibody (Cy3)
orb2591418 100 µg

MSin3A/SIN3A Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
B-Myb Rabbit Polyclonal Antibody
APRab07612-01 20 µL

B-Myb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B-Myb Rabbit Polyclonal Antibody
APRab07612-02 50 µL

B-Myb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details