Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantM-CSF, Rat

Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells [2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4].

Product Specifications

Product Name Alternative

Macrophage Colony Stimulating Factor, CSF-1, Lanimostim, MCSF, M-CSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 4x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

32-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80 °C from date of receipt. Upon reconstitution, rrM-CSF should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQ ELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMC10 siRNA (Rat)
orb1829664-01 15 nmol

EMC10 siRNA (Rat)

Sign In for Pricing
View Details
EMC10 siRNA (Rat)
orb1829664-02 30 nmol

EMC10 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Catalase (CAT) ELISA Kit-Sandwich
EK6F178-01 48 Test

Mouse Catalase (CAT) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Catalase (CAT) ELISA Kit-Sandwich
EK6F178-02 96 Tests

Mouse Catalase (CAT) ELISA Kit-Sandwich

Sign In for Pricing
View Details
SULF2, CT (SULF2, KIAA1247, Extracellular sulfatase Sulf-2) (MaxLight 650)
MBS6352475-01 0.1 mL

SULF2, CT (SULF2, KIAA1247, Extracellular sulfatase Sulf-2) (MaxLight 650)

Sign In for Pricing
View Details
SULF2, CT (SULF2, KIAA1247, Extracellular sulfatase Sulf-2) (MaxLight 650)
MBS6352475-02 5x 0.1 mL

SULF2, CT (SULF2, KIAA1247, Extracellular sulfatase Sulf-2) (MaxLight 650)

Sign In for Pricing
View Details