What is the catalog number for Human SSTR2-VLPs Protein?

The catalog number for Human SSTR2-VLPs Protein is orb1478128.

What sizes are available for Human SSTR2-VLPs Protein?

Human SSTR2-VLPs Protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SSTR2-VLPs Protein come in?

Human SSTR2-VLPs Protein is available in 3 different pack sizes.

Is Human SSTR2-VLPs Protein in stock?

Human SSTR2-VLPs Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human SSTR2-VLPs Protein

This Human SSTR2-VLPs Protein spans the sequence from region 1-369aa.

Product Specifications

Product Name Alternative

SSTR2, Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

UniProt

P30874

Expression Region

1-369aa

Tag

C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/ml can bind Anti-SSTR2 recombinant antibody, the EC50 is 58.13-81.28 ng/mL.

Form

Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI