Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B, Human/Cynomolgus (HEK293, hFc)

ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Human/Cynomolgus (HEK293, hFc) is produced in HEK293 cells with a C-Terminal hFc-tag.

Product Specifications

Product Name Alternative

ACVR2B Protein, Human/Cynomolgus (HEK293, hFc), Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2b-protein-human-hek293-fc.html

Purity

97.00

Smiles

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT

Molecular Formula

93/102118668 (Gene_ID) Q13705-1 (S19-T134) /XP_045242398.1 (S40-T155) (Accession)

Molecular Weight

Approximately 55-70 kDa due to the glycosylation.

References & Citations

[1]Johanna Magga, et al. Systemic Blockade of ACVR2B Ligands Protects Myocardium from Acute Ischemia-Reperfusion Injury. Mol Ther. 2019 Mar 6;27 (3) :600-610.|[2]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[3]Rafael Barreto, et al. ACVR2B/Fc counteracts chemotherapy-induced loss of muscle and bone mass. Sci Rep. 2017 Oct 31;7 (1) :14470.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR1 Protein Vector (Rat) (pPM-C-HA)
PV303192 500 ng

S1PR1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Ethyl 2-amino-3-bromo-5-pyridinecarboxylate
sc-263169 500 mg

Ethyl 2-amino-3-bromo-5-pyridinecarboxylate

Sign In for Pricing
View Details
Adam12 (NM_007400) Mouse Tagged ORF Clone Lentiviral Particle
MR225285L2V 200 µL

Adam12 (NM_007400) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KLF9 Peptide - N-terminal region (AAP58083)
AAP58083-100UG 100 µg

KLF9 Peptide - N-terminal region (AAP58083)

Sign In for Pricing
View Details
SGSM3 Recombinant Protein Antigen
NBP2-13304PEP 0.1 mL

SGSM3 Recombinant Protein Antigen

Sign In for Pricing
View Details
D- (-) Arabinose
GC205006-10g 10 g

D- (-) Arabinose

Sign In for Pricing
View Details