Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avian infectious bronchitis virus Non-structural protein 5b Protein

This Avian infectious bronchitis virus Non-structural protein 5b Protein spans the amino acid sequence from region 1-82aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ns5b) (Accessory protein 5b)

UniProt

Q80RZ3

Expression Region

1-82aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNNSKDNPFCGAIARKARIYLREGLDCVYFLNKAGQAESCPACTSLVFQGKTCEEHKYNNNLLSWQAVRQLERQMPQLQSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRTC3 Antibody
orb2679840-01 50 µL

CRTC3 Antibody

Sign In for Pricing
View Details
CRTC3 Antibody
orb2679840-02 100 µL

CRTC3 Antibody

Sign In for Pricing
View Details
CRTC3 Antibody
orb2679840-03 200 µL

CRTC3 Antibody

Sign In for Pricing
View Details
SD-1008
HY-107595-01 5 mg

SD-1008

Sign In for Pricing
View Details
SD-1008
HY-107595-02 10 mg

SD-1008

Sign In for Pricing
View Details
Mouse Protein dpy-19 homolog 4, Dpy19l4 ELISA KIT
ELI-46833m 96 Tests

Mouse Protein dpy-19 homolog 4, Dpy19l4 ELISA KIT

Sign In for Pricing
View Details