Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ModA Protein

Recombinant Escherichia coli Molybdate-binding periplasmic protein (modA)

Product Specifications

Product Name Alternative

Molybdate/tungstate-binding protein ModA

UniProt

P37329

Expression Region

25-257aa

Tag

Tag-Free

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Non-Animal

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEGKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-Protein, alpha (Goa) (APC)
MBS6242225-01 0.1 mL

G-Protein, alpha (Goa) (APC)

Sign In for Pricing
View Details
G-Protein, alpha (Goa) (APC)
MBS6242225-02 5x 0.1 mL

G-Protein, alpha (Goa) (APC)

Sign In for Pricing
View Details
Ubiquitin (pS65) Blocking Peptide
CBP5761-01 1 mg

Ubiquitin (pS65) Blocking Peptide

Sign In for Pricing
View Details
Ubiquitin (pS65) Blocking Peptide
CBP5761-02 5 mg

Ubiquitin (pS65) Blocking Peptide

Sign In for Pricing
View Details
5-Propargylamino-CTP – ATTO-565
JBS-NU-831-565 80 µL

5-Propargylamino-CTP – ATTO-565

Sign In for Pricing
View Details
LRG1 Rabbit mAb
AB102867 100 µL

LRG1 Rabbit mAb

Sign In for Pricing
View Details